Cedar Ridge Mobile Home & RV Park Introduce
Howdy, Texas residents! Are you searching for a unique and welcoming place to park your RV or set down roots in a mobile home right here in the bustling heart of Dallas? Look no further than Cedar Ridge Mobile Home & RV Park. This distinctive community, affectionately described by its manager as "a little bit of Mayberry in Dallas," offers a blend of community spirit and practical living solutions for those seeking a safe and established environment.
In this comprehensive article, we'll delve into what makes Cedar Ridge Mobile Home & RV Park a noteworthy option for locals across the Lone Star State. We'll explore its strategic location in South Dallas, the range of services it provides, its unique features and highlights, and all the essential contact information you’ll need to explore this vibrant community further. Get ready to discover if Cedar Ridge could be your next home, whether on wheels or on a foundation.
Cedar Ridge Mobile Home & RV Park is a residential community located in South Dallas, Texas, designed to accommodate both recreational vehicles and mobile homes. It's a place that prides itself on fostering a strong sense of community and providing a secure environment for its residents. The park offers a unique blend of long-term RV parking and mobile home lots, catering to a diverse range of individuals and families. What sets Cedar Ridge apart is its distinct character, described by some as having a charm reminiscent of a close-knit, classic American town.
Visitors and residents alike often note the visible sense of camaraderie and neighborly watchfulness within the park. This community aspect is a significant draw, suggesting a place where people look out for one another. The park also appears to be a haven for animal lovers, with well-cared-for pets and even friendly "welcome kitties" adding to the homely atmosphere. While the roads may have some "character" due to the nature of a mobile home park that also accommodates large vehicles, this is often seen as part of its authentic charm rather than a significant drawback. The management is described as having a keen eye on protecting the community, aiming to maintain order and a positive living environment, even if new policies might sometimes feel stringent to some residents.
Cedar Ridge Mobile Home & RV Park is conveniently situated at 5800 S Lancaster Rd, Dallas, TX 75241, USA. This address places it squarely in South Dallas, a part of the sprawling Dallas-Fort Worth Metroplex, one of the largest and most dynamic urban areas in Texas.
For Texans, especially those in the DFW metroplex, this location offers significant accessibility. South Lancaster Road is a key thoroughfare, providing relatively easy access to major highways and interstates, including I-35E and I-20, which are vital for commuting throughout Dallas and beyond. This connectivity means residents can reach downtown Dallas, its extensive employment centers, cultural attractions, and entertainment venues within a reasonable drive. Essential amenities such as grocery stores, retail shopping centers, healthcare facilities, and various dining options are also readily available in the surrounding South Dallas area. Public transportation, including DART (Dallas Area Rapid Transit) bus routes, likely serves this area, providing an alternative for those without private vehicles. The strategic placement in South Dallas allows residents to enjoy the conveniences of urban living while residing in a more structured community environment. This balance of urban access and community living makes Cedar Ridge a practical choice for locals seeking a well-located base in the Dallas area.
RV and Mobile Home Lots: The park provides dedicated spaces for both recreational vehicles (RVs) and mobile homes, catering to both temporary and long-term residents. This dual accommodation makes it versatile for various housing needs.
Essential Utility Hookups: While not explicitly detailed, it is standard for RV and mobile home parks of this nature to offer essential utility hookups, including electricity, water, and sewer connections at each lot, ensuring residents have access to necessary services.
Property Management: The park is overseen by a management team. Their role includes maintaining the property, enforcing park rules, and striving to protect the community's environment. Residents have direct contact with management for concerns and inquiries.
Community Oversight and Rule Enforcement: Management actively sends out reminders and notices regarding park rules, covering aspects like vehicle limits and pet policies. This ensures an organized environment, although perceptions of these policies can vary among residents.
Safe and Secure Environment: A primary highlight mentioned by residents is the park's reputation as a "safe place to park or live." This sense of security is highly valued, particularly in an urban setting like Dallas, offering peace of mind to residents.
Strong Sense of Community: Cedar Ridge fosters a notable sense of community. Residents often describe an atmosphere where neighbors look out for one another, creating a supportive and friendly living environment. This communal spirit is a significant draw.
Pet-Friendly Atmosphere: The park appears to be welcoming to animals, with observations of "well cared for + happy" animals and the presence of "welcome kitties." While there are specific rules regarding pets (e.g., feeding strays), the overall vibe suggests a place that accommodates animal companions.
Unique Character and Charm: The park possesses a distinctive character, described as "a little bit of Mayberry in Dallas." This unique charm, including "rough and bumpy" roads that add to its character, sets it apart from more conventional housing options and appeals to those seeking something different.
Accommodates Diverse Housing Types: Cedar Ridge is unique in its accommodation of various housing options, from RVs to mobile homes and even "tiny houses," indicating a versatile and inclusive community.
Active Management Presence: While some residents may find new rules stringent, the active presence of management who "has their eye out to protect its domain" implies a well-managed park striving for order and resident safety.
For more information about Cedar Ridge Mobile Home & RV Park, including availability and park policies, please use the following contact details:
Address: 5800 S Lancaster Rd, Dallas, TX 75241, USA
Phone: (214) 382-2998
Mobile Phone: +1 214-382-2998
For Texas residents, particularly those in the vast and dynamic Dallas-Fort Worth Metroplex, Cedar Ridge Mobile Home & RV Park offers a uniquely suitable living solution. Its strategic location in South Dallas provides convenient access to the myriad opportunities that Dallas offers, from extensive employment sectors to world-class entertainment and cultural venues, all within a reasonable commute. This accessibility allows residents to enjoy the vibrancy of city life while returning to a community that prioritizes safety and a distinct neighborhood feel.
What truly makes Cedar Ridge suitable for locals is its compelling blend of affordability and community. In an urban area where housing costs can be significant, the option for RV or mobile home living at Cedar Ridge provides a more accessible pathway to a stable residence. Beyond the practicalities, the park’s strong sense of community, often described as neighbors looking out for neighbors, fosters a welcoming and supportive environment that many Texans cherish. While management implements rules for the collective good, this oversight aims to maintain order and the park's positive character, which includes its unique charm and pet-friendly atmosphere. For Texas residents seeking a secure, community-focused, and character-filled place to call home, whether temporarily in an RV or long-term in a mobile home, Cedar Ridge Mobile Home & RV Park presents a compelling and distinctive option right in the heart of Dallas.
Alternative Option
Cedar Ridge Mobile Home & RV Park From visitors
RV Park
- Mobile Home Park
Cedar Ridge Mobile Home & RV Park Details
Offerings
- RV camping
Amenities
- Running water
Payments
- Credit cards
Pets
- Dogs allowed
Cedar Ridge Mobile Home & RV Park Photos










Cedar Ridge Mobile Home & RV Park Location
Cedar Ridge Mobile Home & RV Park
5800 S Lancaster Rd, Dallas, TX 75241, USA
Cedar Ridge Mobile Home & RV Park Reviews
managementdepositownertheftmobile home parkpayreviewslawyercashdriving
★ 5★ 4★ 3★ 2★ 1"A little bit of Mayberry in Dallas" that's a quote from the manager of Cedar Ridge RV+ Mobile Home Park. This place is definitely worth exploring if you have need of a safe place to park or live in your RV / Mobile home in South Dallas...there is a tiny House that found a nice place there !I like driving through seeing a sense of community and I see that the animals are well cared for + they are happy also seem to be a few welcome kitties to make you feel at home. I get a sense that everyone has a job to do at this place and that is looking out for their neighbor. Yes the roads are a little rough and bumpy due to hauling big homes up hills which also give it character..definitely some funny people definitely some animal people and definitely management that has their eye out to protect it's domain. Cedar Ridge mobile home and RV Park
February 02 · Lee MI've lived here for a quite a while, had no complaints. But now, turns out you can't even have more than 2 cars in a lot you VERY MUCH pay for... or they'll tow your car. seriously? Even feeding a stray cat you see wandering around will get you a fine of $250. yeah, what a "great" and "welcoming" place you got here. This new management always sending more and more papers & reminders about charging fines if you dont do this or dont do that. Starting to feel like im in a dictatorship here 😂
September 18 · criptyc cyberI moved into this place at the beginning of August. With very poor management, I decided to get out of there as soon as possible. I had to buy a new breaker after it kept throwing and they refused to replace it. I ended up replacing it myself and never had a problem from it again. As I said, I moved out very quickly and before leaving the management promised me my deposit back. It has been over 4 months and they have yet to do so. I have contacted the manager (Jennifer) and she has given me many excuses and keeps lying to me telling me it will come in the mail. She needs to refund me and all the others that she has scammed. As a result, Jennifer and the owner should be behind bars.
December 13 · Rodney BassThe manager is racist towards us hispanics. We just moved here a couple months back and at first the manager lady seemed nice and was very kind friendly towards us, but later, she began having problems with us out of the blue. this lady is nothing but disrespectful towards us. My dad was trying to solve some problems with her and was talking to her in a calm voice but she began cussing him out and telling him that she could do anything she wants just because she was the manager. Which is not fair at all. She also seems to have a huge problem with our dog. He always barks at her because he gets a bad vibe from her. And dogs usually know when a person is bad (and he’s not wrong) but she’s always threatening us saying that she’s gonna put my dog in the dog pound (literally just because he barks at strangers which is normal for dogs) and plenty of times is other dogs barking not mine but it’s easier to blame my dog just cause it’s us. Last time we caught her just standing outside our yard with her dog provoking my dog to bark. We started filming her weird behavior and she then proceed to walk away. But anyways, she seems to have a huge problem with us and she’s willing to do anything to kick us out (her words) so please, before thinking of moving here, I beg you to reconsider. DO NOT MOVE HERE. The manager is rude, disrespectful, and just downright mean. That’s why I’m giving this place one star. Because this is the worst place I’ve ever lived in. It feels like we’re living in a prison. This manager doesn’t let us do anything at all. Actually worse than a prison. If I could give this place 0 stars I would. It doesn’t even deserve 1 star.
February 22 · Veronica GuadalupeLove this place!! The people are very nice and the park gets better looking every time we visit!! Jennifer is doing something right.A lot of complaints about mail and deposits:(- rules are rules. Jennifer is the manager, not the owner. Don’t shoot the messenger. I’ve never had a problem. The mail is a post office issue. (I’ve had mail stolen from my house- it’s not the landlords fault, unfortunate as it is).People like to post when there is a complaint. I wish the folks who have had emergency repairs done and errands ran and numerous other neat perks to being here are performed would post reviews.This place, the staff and the people we have met here are priceless:)
January 01 · Daina Harper
Categories
Top Visited Sites
The Golden Chipmunk Campground / Resort Wascott WI5.0 (2 reviews)
Freedom RV Resort4.0 (48 reviews)
Mallard Mobile Home Park4.0 (36 reviews)
Erie Meadows5.0 (1 reviews)
Humble Estates LLC0.0 (0 reviews)
Woodland Campground4.0 (16 reviews)Top Camping Searches
Trending The Campfire Posts
Best Family-Friendly Campsites With Swimming Areas for Your Next Adventure
Best Winter Campsites for Cozy Cabin Rentals
How to Set Up a Tent in Windy Conditions Like a Pro
Best Campfire Tools for Backpackers: Expert Gear Guide for Hikers
How to Protect Your Gear from Rain While Camping
Best Campfire Recipes for Easy Meals | Camp Spotter
