Camp Spotter
The CampfireCamping Near MeRV Parks Near Me​Cottages Near Me​
AlabamaArizonaArkansasCaliforniaColoradoConnecticutDelawareDistrict of ColumbiaFloridaGeorgiaIdahoIllinoisIndianaIowaKansasKentuckyLouisianaMaineMarylandMassachusettsMichiganMinnesotaMississippiMissouriMontanaNebraskaNevadaNew HampshireNew JerseyNew MexicoNew YorkNorth CarolinaNorth DakotaOhioOklahomaOregonPennsylvaniaRhode IslandSouth CarolinaSouth DakotaTennesseeTexasUtahVermontVirginiaWashingtonWest VirginiaWisconsinWyoming
AlabamaArizonaArkansasCaliforniaColoradoConnecticutDelawareDistrict of ColumbiaFloridaGeorgiaIdahoIllinoisIndianaIowaKansasKentuckyLouisianaMaineMarylandMassachusettsMichiganMinnesotaMississippiMissouriMontanaNebraskaNevadaNew HampshireNew JerseyNew MexicoNew YorkNorth CarolinaNorth DakotaOhioOklahomaOregonPennsylvaniaRhode IslandSouth CarolinaSouth DakotaTennesseeTexasUtahVermontVirginiaWashingtonWest VirginiaWisconsinWyoming
AlabamaArizonaArkansasCaliforniaColoradoConnecticutDelawareDistrict of ColumbiaFloridaGeorgiaIdahoIllinoisIndianaIowaKansasKentuckyLouisianaMaineMarylandMassachusettsMichiganMinnesotaMississippiMissouriMontanaNebraskaNevadaNew HampshireNew JerseyNew MexicoNew YorkNorth CarolinaNorth DakotaOhioOklahomaOregonPennsylvaniaRhode IslandSouth CarolinaSouth DakotaTennesseeTexasUtahVermontVirginiaWashingtonWest VirginiaWisconsinWyoming
Camp SpotterRV Parks Near Me​TexasDallas CountyDallasRV Parks ​ in South Lancaster RoadCedar Ridge Mobile Home & RV Park
Cedar Ridge Mobile Home & RV Park ico

Cedar Ridge Mobile Home & RV Park

RV park, Recreational vehicle rental agency ★3.0

5800 S Lancaster Rd, Dallas, TX 75241, USA

3.0
"A little bit of Mayberry in Dallas" that's a quote from the manager of Cedar Ridge RV+ Mobile Home Park. This place is definitely worth exploring if you have need of a safe place to park or live in your RV / Mobile home in South Dallas...there is a tiny House that found a nice place there !I like driving through seeing a sense of community and I see that the animals are well cared for + they are happy also seem to be a few welcome kitties to make you feel at home. I get a sense that everyone has a job to do at this place and that is looking out for their neighbor. Yes the roads are a little rough and bumpy due to hauling big homes up hills which also give it character..definitely some funny people definitely some animal people and definitely management that has their eye out to protect it's domain. Cedar Ridge mobile home and RV Park - Lee M
Cedar Ridge Mobile Home & RV Park Overview Intro From visitors Detail Photos Location Reviews

Cedar Ridge Mobile Home & RV Park Introduce

Howdy, Texas residents! Are you searching for a unique and welcoming place to park your RV or set down roots in a mobile home right here in the bustling heart of Dallas? Look no further than Cedar Ridge Mobile Home & RV Park. This distinctive community, affectionately described by its manager as "a little bit of Mayberry in Dallas," offers a blend of community spirit and practical living solutions for those seeking a safe and established environment.

In this comprehensive article, we'll delve into what makes Cedar Ridge Mobile Home & RV Park a noteworthy option for locals across the Lone Star State. We'll explore its strategic location in South Dallas, the range of services it provides, its unique features and highlights, and all the essential contact information you’ll need to explore this vibrant community further. Get ready to discover if Cedar Ridge could be your next home, whether on wheels or on a foundation.

Introduction / Overview

Cedar Ridge Mobile Home & RV Park is a residential community located in South Dallas, Texas, designed to accommodate both recreational vehicles and mobile homes. It's a place that prides itself on fostering a strong sense of community and providing a secure environment for its residents. The park offers a unique blend of long-term RV parking and mobile home lots, catering to a diverse range of individuals and families. What sets Cedar Ridge apart is its distinct character, described by some as having a charm reminiscent of a close-knit, classic American town.

Visitors and residents alike often note the visible sense of camaraderie and neighborly watchfulness within the park. This community aspect is a significant draw, suggesting a place where people look out for one another. The park also appears to be a haven for animal lovers, with well-cared-for pets and even friendly "welcome kitties" adding to the homely atmosphere. While the roads may have some "character" due to the nature of a mobile home park that also accommodates large vehicles, this is often seen as part of its authentic charm rather than a significant drawback. The management is described as having a keen eye on protecting the community, aiming to maintain order and a positive living environment, even if new policies might sometimes feel stringent to some residents.

Location and Accessibility

Cedar Ridge Mobile Home & RV Park is conveniently situated at 5800 S Lancaster Rd, Dallas, TX 75241, USA. This address places it squarely in South Dallas, a part of the sprawling Dallas-Fort Worth Metroplex, one of the largest and most dynamic urban areas in Texas.

For Texans, especially those in the DFW metroplex, this location offers significant accessibility. South Lancaster Road is a key thoroughfare, providing relatively easy access to major highways and interstates, including I-35E and I-20, which are vital for commuting throughout Dallas and beyond. This connectivity means residents can reach downtown Dallas, its extensive employment centers, cultural attractions, and entertainment venues within a reasonable drive. Essential amenities such as grocery stores, retail shopping centers, healthcare facilities, and various dining options are also readily available in the surrounding South Dallas area. Public transportation, including DART (Dallas Area Rapid Transit) bus routes, likely serves this area, providing an alternative for those without private vehicles. The strategic placement in South Dallas allows residents to enjoy the conveniences of urban living while residing in a more structured community environment. This balance of urban access and community living makes Cedar Ridge a practical choice for locals seeking a well-located base in the Dallas area.

Services Offered

  • RV and Mobile Home Lots: The park provides dedicated spaces for both recreational vehicles (RVs) and mobile homes, catering to both temporary and long-term residents. This dual accommodation makes it versatile for various housing needs.

  • Essential Utility Hookups: While not explicitly detailed, it is standard for RV and mobile home parks of this nature to offer essential utility hookups, including electricity, water, and sewer connections at each lot, ensuring residents have access to necessary services.

  • Property Management: The park is overseen by a management team. Their role includes maintaining the property, enforcing park rules, and striving to protect the community's environment. Residents have direct contact with management for concerns and inquiries.

  • Community Oversight and Rule Enforcement: Management actively sends out reminders and notices regarding park rules, covering aspects like vehicle limits and pet policies. This ensures an organized environment, although perceptions of these policies can vary among residents.

Features / Highlights

  • Safe and Secure Environment: A primary highlight mentioned by residents is the park's reputation as a "safe place to park or live." This sense of security is highly valued, particularly in an urban setting like Dallas, offering peace of mind to residents.

  • Strong Sense of Community: Cedar Ridge fosters a notable sense of community. Residents often describe an atmosphere where neighbors look out for one another, creating a supportive and friendly living environment. This communal spirit is a significant draw.

  • Pet-Friendly Atmosphere: The park appears to be welcoming to animals, with observations of "well cared for + happy" animals and the presence of "welcome kitties." While there are specific rules regarding pets (e.g., feeding strays), the overall vibe suggests a place that accommodates animal companions.

  • Unique Character and Charm: The park possesses a distinctive character, described as "a little bit of Mayberry in Dallas." This unique charm, including "rough and bumpy" roads that add to its character, sets it apart from more conventional housing options and appeals to those seeking something different.

  • Accommodates Diverse Housing Types: Cedar Ridge is unique in its accommodation of various housing options, from RVs to mobile homes and even "tiny houses," indicating a versatile and inclusive community.

  • Active Management Presence: While some residents may find new rules stringent, the active presence of management who "has their eye out to protect its domain" implies a well-managed park striving for order and resident safety.

Contact Information

For more information about Cedar Ridge Mobile Home & RV Park, including availability and park policies, please use the following contact details:

Address: 5800 S Lancaster Rd, Dallas, TX 75241, USA

Phone: (214) 382-2998

Mobile Phone: +1 214-382-2998

Conclusion: Why This Place is Suitable for Locals

For Texas residents, particularly those in the vast and dynamic Dallas-Fort Worth Metroplex, Cedar Ridge Mobile Home & RV Park offers a uniquely suitable living solution. Its strategic location in South Dallas provides convenient access to the myriad opportunities that Dallas offers, from extensive employment sectors to world-class entertainment and cultural venues, all within a reasonable commute. This accessibility allows residents to enjoy the vibrancy of city life while returning to a community that prioritizes safety and a distinct neighborhood feel.

What truly makes Cedar Ridge suitable for locals is its compelling blend of affordability and community. In an urban area where housing costs can be significant, the option for RV or mobile home living at Cedar Ridge provides a more accessible pathway to a stable residence. Beyond the practicalities, the park’s strong sense of community, often described as neighbors looking out for neighbors, fosters a welcoming and supportive environment that many Texans cherish. While management implements rules for the collective good, this oversight aims to maintain order and the park's positive character, which includes its unique charm and pet-friendly atmosphere. For Texas residents seeking a secure, community-focused, and character-filled place to call home, whether temporarily in an RV or long-term in a mobile home, Cedar Ridge Mobile Home & RV Park presents a compelling and distinctive option right in the heart of Dallas.

Cedar Ridge Mobile Home & RV Park From visitors

  • RV Park

  • Mobile Home Park

Cedar Ridge Mobile Home & RV Park Details

  • Offerings

  • RV camping
  • Amenities

  • Running water
  • Payments

  • Credit cards
  • Pets

  • Dogs allowed

Cedar Ridge Mobile Home & RV Park Photos

Cedar Ridge Mobile Home & RV Park Picture 1Cedar Ridge Mobile Home & RV Park Picture 2Cedar Ridge Mobile Home & RV Park Picture 3Cedar Ridge Mobile Home & RV Park Picture 4Cedar Ridge Mobile Home & RV Park Picture 5Cedar Ridge Mobile Home & RV Park Picture 6Cedar Ridge Mobile Home & RV Park Picture 7Cedar Ridge Mobile Home & RV Park Picture 8Cedar Ridge Mobile Home & RV Park Picture 9Cedar Ridge Mobile Home & RV Park Picture 10

Cedar Ridge Mobile Home & RV Park Location

Cedar Ridge Mobile Home & RV Park

5800 S Lancaster Rd, Dallas, TX 75241, USA

Cedar Ridge Mobile Home & RV Park Reviews

An average rating of ★3.1 from 112 user reviews.

managementdepositownertheftmobile home parkpayreviewslawyercashdriving

★ 5★ 4★ 3★ 2★ 1

Categories

Top Visited Sites

Top Searches

Trending The Campfire Posts